X
Email:
sales@ruixibiotech.com

CRF Peptide (Bovine),CAS: 92307-52-3

Corticotropin Releasing Factor Peptide (Bovine)

Catalog # Pkg Size Price(USD) Quantity Buy this product
R-M-1405 1mg 180.00
- +
+ Add to cart

Product description

Corticotropin releasing factor (CRF), a hormone from the hypothalamus, regulates the release of corticotropin (ACTH) and endorphin from the pituitary gland. CRF is also a neurotransmitter in the central nervous system, and is involved in autonomic and endocrine responses to stress.


Appearance N/A
Molecular weight N/A
Purity >90%
Solubility N/A
Cas 92307-52-3
Synonyms Corticotropin-releasing factor; CRF; corticotropin-releasing hormone; CRH; corticoliberin
Sequence H-Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Asn-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2 or H-SQEPPISLDLTFHLLREVLEMTKADQLAQQAHNNRKLLDIA-NH2
Molecular Formula  C206H340N60O63S
Storage -20℃, protected from light and moisture
Transportation 4-25℃ temperature for up to 3 weeks
Stability 1 year
Document

Related Product