Copeptin (rat) trifluoroacetate salt,CAS : 86280-64-0

H-Ala-Arg-Glu-Gln-Ser-Asn-Ala-Thr-Gln-Leu-Asp-Gly-Pro-Ala-Arg-Glu-Leu-Leu-Leu-Arg-Leu-Val-Gln-Leu-Ala-Gly-Thr-Gln-Glu-Ser-Val-Asp-Ser-Ala-Lys-Pro-Arg-Val-Tyr-OH trifluoroacetate salt

Product description

Copeptin (rat) trifluoroacetate salt,CAS : 86280-64-0 from ruixi.It is a synthetic peptide, which is only used for scientific research, not for human body.

Appearance	N/A
Molecular weight	N/A
Purity	>90%
Solubility	N/A
Cas	86280-64-0
Sequence	AREQSNATQLDGPARELLLRLVQLAGTQESVDSAKPRVY
Molecular Formula	C₁₈₃H₃₀₇N₅₇O₆₁
Storage	-20℃,protected from light and moisture
Transportation	4-25℃ temperature for up to 2 weeks
Stability	1 year

Document

msds of Copeptin (rat) trifluoroacetate salt

Related Product

• cortistatin-17-human-trifluoroacetate-salt