Chlorotoxin trifluoroacetate salt
Chlorotoxin trifluoroacetate salt
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-788 | 0.5mg | 390.00 | + Add to cart |
|
R-M-788 | 1mg | 650.00 | + Add to cart |
|
|
Product description
Chlorotoxin trifluoroacetate salt,CAS : 163515-35-3 from ruixi.As chlorotoxin targets cancer cells, it was conjugated to drugs as cisplatin or dyes.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 163515-35-3 |
Sequence | MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH₂ |
Synonyms | Cltx (Egyptian scorpion) |
Molecular Formula | C₁₅₈H₂₄₉N₅₃O₄₇S₁₁ |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product