Calcitonin Gene Related Peptide 2,Cas:98824-26-1
Calcitonin Gene Related Peptide 2
Product description
Calcitonin Gene Related Peptide II (CGRP II) is produced in central and peripheral neurons and binds to the herterodimeric CGRP receptors found throughout the body. It has roles in modulating the autonomic nervous system, appetite suppression, gastric acid release, temperature homeostasis, and heart rate. CGRP exists in two forms CGRP I (CGRPalpha;) and CGRP II (CGRPbeta;)Calcitonin gene-related peptide-2 (CGRP-II) induces vasodilatation.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 98824-26-1 |
Sequence | Human: H-Ala-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2 (Cys2-Cys7) or H-ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2 (Cys2-Cys7) |
Molecular Formula | C162H267N51O48S3 |
Storage | -20℃,protected from light and moisture |
Transportation | 4-25℃ temperature for up to 2 weeks |
Stability | 1 year |
Document
Related Product