X
Email:
sales@ruixibiotech.com

Calcitonin Gene Related Peptide 2,Cas:98824-26-1

Calcitonin Gene Related Peptide 2

Catalog # Pkg Size Price(USD) Quantity Buy this product
R-M-1428 1mg 300.00
- +
+ Add to cart

Product description

Calcitonin Gene Related Peptide II (CGRP II) is produced in central and peripheral neurons and binds to the herterodimeric CGRP receptors found throughout the body. It has roles in modulating the autonomic nervous system, appetite suppression, gastric acid release, temperature homeostasis, and heart rate. CGRP exists in two forms CGRP I (CGRPalpha;) and CGRP II (CGRPbeta;)Calcitonin gene-related peptide-2 (CGRP-II) induces vasodilatation.


Appearance N/A
Molecular weight N/A
Purity >90%
Solubility N/A
Cas 98824-26-1
Sequence Human: H-Ala-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2 (Cys2-Cys7) or H-ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2 (Cys2-Cys7)
Molecular Formula C162H267N51O48S3
Storage -20℃,protected from light and moisture
Transportation 4-25℃ temperature for up to 2 weeks
Stability 1 year
Document

Related Product