C5a Anaphylatoxin (human) trifluoroacetate salt
C5a Anaphylatoxin (human) trifluoroacetate salt
Product description
C5a Anaphylatoxin (human) trifluoroacetate salt,CAS :1816940-05-2 from ruixi.Complement 5a plays a central role in host defenses and is implicated in functions associated with sepsis, adult respiratory distress syndrome, rheumatoid arthritis, psoriasis, neurodegeneration, and ischaemia/reperfusion injury. The molecule has potent chemoattractant and pro-inflammatory properties.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 1816940-05-2 |
Sequence | TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR |
Molecular Formula | C₃₅₀H₅₇₈N₁₀₈O₁₀₇S₈ |
Storage | -20℃,protected from light and moisture |
Transportation | 4-25℃ temperature for up to 2 weeks |
Stability | 1 year |
Document
Related Product