X
Email:
sales@ruixibiotech.com

Big Endothelin 1 [1-38] Peptide

Big Endothelin 1 [1-38] Peptide

Catalog # Pkg Size Price(USD) Quantity Buy this product
R-M-1437 1mg 850.00
- +
+ Add to cart

Product description

Endothelins are endothelium-derived vasoconstrictor peptides. Endothelin-1 is expressed as a 212-aa precursor (preproendothelin-1) that is sequentially cleaved into 2 chains: Endothelin-1 (21 aa) and Big Endothelin-1 (38 aa). Big endothelin-1 is cleaved to yield endothelin-1 via the activity of an endothelin-converting enzyme (ECE). Big Endothelin-1 can be hydrolyzed by chymase to generate endothelin 1 (1-21) in vitro.


Appearance N/A
Molecular weight N/A
Purity >90%
Solubility N/A
Synonyms Big endothelin-1; endothelin-1; preproendothelin-1; PPET1; ET-1; EDN1
Sequence Human: H-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys-Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-Val-Asn-Thr-Pro-Glu-His-Val-Val-Pro-Tyr-Gly-Leu-Gly-Ser-Pro-Arg-Ser-OH (Cys1-Cys15, Cys3-Cys11) or H-CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS-OH (Cys1-Cys15, Cys3-C
Molecular Formula C189H282N48O56S5
Storage -20℃,protected from light and moisture
Transportation 4-25℃ temperature for up to 2 weeks
Stability 1 year
Document

Related Product