Beta Amyloid [1-40] Peptide (Rat),Cas:144409-98-3
Beta Amyloid [1-40] Peptide (Rat)
Product description
Beta Amyloid (1-40), rat is a form of the amyloid β-peptide found in plaques associated with Alzheimer disease. It has both neurotrophic and neurotoxic effects and may affect synaptic plasticity.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 144409-98-3 |
Sequence | Rat: H-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH or H-DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH |
Molecular Formula | C190H291N51O57S1 |
Storage | -20℃,protected from light and moisture |
Transportation | 4-25℃ temperature for up to 2 weeks |
Stability | 1 year |
Document
Related Product