X
Email:
sales@ruixibiotech.com

Beta Amyloid [1-40] Peptide (Rat),Cas:144409-98-3

Beta Amyloid [1-40] Peptide (Rat)

Catalog # Pkg Size Price(USD) Quantity Buy this product
R-M-1453 1mg 229.00
- +
+ Add to cart

Product description

Beta Amyloid (1-40), rat is a form of the amyloid β-peptide found in plaques associated with Alzheimer disease. It has both neurotrophic and neurotoxic effects and may affect synaptic plasticity.


Appearance N/A
Molecular weight N/A
Purity >90%
Solubility N/A
Cas 144409-98-3
Sequence Rat: H-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH or H-DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH
Molecular Formula C190H291N51O57S1
Storage -20℃,protected from light and moisture
Transportation 4-25℃ temperature for up to 2 weeks
Stability 1 year
Document

Related Product