X
Email:
sales@ruixibiotech.com

Beta Amyloid [1-40] Peptide,CAS: 131438-79-4

Beta Amyloid [1-40] Peptide

Catalog # Pkg Size Price(USD) Quantity Buy this product
R-M-1455 1mg 205.00
- +
+ Add to cart

Product description

Beta-amyloid production results from cleavage in the extracellular domain of APP by the beta-secretase (BACE1) , which results in the production of the APP C-terminal fragment C99. This fragment is further cleaved by the gamma-secretase at residues 40-42 to produce beta-amyloid 40 and 42 peptides. Beta-amyloid aggregation and neuritic plaque formation are pathologic hallmarks of Alzheimer disease. This peptide corresponds to the human beta-amyloid 1-40 peptide.


Appearance N/A
Molecular weight N/A
Purity >90%
Solubility N/A
Cas 131438-79-4
Sequence H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH
Molecular Formula C194H295N53O58S1
Storage -20℃,protected from light and moisture
Transportation 4-25℃ temperature for up to 2 weeks
Stability 1 year
Document

Related Product