AMYLOID-Β (1-40),Cas :131438-79-4
AMYLOID-Β (1-40)
Product description
Amyloid-β (Aβ) is a peptide cleavage product of amyloid precursor protein (APP) that is often used as a biomarker in Alzheimer disease. Misfolded Aβ oligomers instigate conformation changes in other, normally folded Aβ oligomers, increasing the number of misfolded proteins and eventually forming neurotoxic plaques. These plaques impair cognitive performance in vivo. Aβ (1-42) is more fibrillogenic and more highly associated with Alzheimer disease than Aβ (1-40), although the shorter form is more common.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 131438-79-4 |
Sequence | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV/Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val |
Molecular Formula | C194H295N53O58S |
Storage | -20℃,protected from light and moisture |
Transportation | 4-25℃ temperature for up to 2 weeks |
Stability | 1 year |
Document
Related Product