X
Email:
sales@ruixibiotech.com

AMYLOID-Β (1-40),Cas :131438-79-4

AMYLOID-Β (1-40)

Catalog # Pkg Size Price(USD) Quantity Buy this product
R-M-1495 1mg 205.00
- +
+ Add to cart

Product description

Amyloid-β (Aβ) is a peptide cleavage product of amyloid precursor protein (APP) that is often used as a biomarker in Alzheimer disease. Misfolded Aβ oligomers instigate conformation changes in other, normally folded Aβ oligomers, increasing the number of misfolded proteins and eventually forming neurotoxic plaques. These plaques impair cognitive performance in vivo. Aβ (1-42) is more fibrillogenic and more highly associated with Alzheimer disease than Aβ (1-40), although the shorter form is more common.


Appearance N/A
Molecular weight N/A
Purity >90%
Solubility N/A
Cas 131438-79-4
Sequence DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV/Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val
Molecular Formula C194H295N53O58S
Storage -20℃,protected from light and moisture
Transportation 4-25℃ temperature for up to 2 weeks
Stability 1 year
Document

Related Product