AMYLIN (8-37), RAT,Cas:138398-61-5
AMYLIN (8-37), RAT
Product description
Amylin is also known as islet amyloid precursor peptide (IAPP) and is co-secreted with insulin from pancreatic β-cells. Amylin is an endogenous peptide hormone that exhibits gastrointestinal motility modulating activity, decreasing gastric emptying and suppressing gastric acid secretion; these actions slow food intake, preventing blood glucose spikes after eating and decreasing insulin demand. Misguided IAPP processing plays a significant role in the development of diabetes mellitus type 2. Like calcitonin, IAPP inhibits osteoclast activity and Ca2+ reabsorption in bones. This peptide binds to calcitonin-RAMP complexes.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 138398-61-5 |
Sequence | ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2/Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 |
Molecular Formula | C₁₄₀H₂₂₇N₄₃O₄₃ |
Storage | -20℃,protected from light and moisture |
Transportation | 4-25℃ temperature for up to 2 weeks |
Stability | 1 year |
Document
Related Product