X
Email:
sales@ruixibiotech.com

AMYLIN (8-37), RAT,Cas:138398-61-5

AMYLIN (8-37), RAT

Catalog # Pkg Size Price(USD) Quantity Buy this product
R-M-1492 2.5mg 390.00
- +
+ Add to cart

Product description

Amylin is also known as islet amyloid precursor peptide (IAPP) and is co-secreted with insulin from pancreatic β-cells. Amylin is an endogenous peptide hormone that exhibits gastrointestinal motility modulating activity, decreasing gastric emptying and suppressing gastric acid secretion; these actions slow food intake, preventing blood glucose spikes after eating and decreasing insulin demand. Misguided IAPP processing plays a significant role in the development of diabetes mellitus type 2. Like calcitonin, IAPP inhibits osteoclast activity and Ca2+ reabsorption in bones. This peptide binds to calcitonin-RAMP complexes.


Appearance N/A
Molecular weight N/A
Purity >90%
Solubility N/A
Cas 138398-61-5
Sequence ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2/Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2
Molecular Formula C₁₄₀H₂₂₇N₄₃O₄₃
Storage -20℃,protected from light and moisture
Transportation 4-25℃ temperature for up to 2 weeks
Stability 1 year
Document

Related Product