Home > products > peptide
> synthetic-peptide
> ala-11-22-28-vip-human-mouse-rat-trifluoroacetate-salt
(Ala¹¹·²²·²⁸)-VIP (human, mouse, rat) trifluoroacetate salt,CAS: 291524-04-4
H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Ala-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Ala-Leu-Asn-Ser-Ile-Leu-Ala-NH₂ trifluoroacetate salt
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-1244 | 0.5mg | 200.00 | + Add to cart |
|
R-M-1244 | 1mg | 360.00 | + Add to cart |
|
|
Product description
Highly selective human VPAC1 receptor agonist. It showed a 1000-fold higher efficiency in stimulating adenylate cyclase activity from VPAC1 than from VPAC2 receptors and therefore represents an effective pharmacological tool to characterize VPAC1 receptor-mediated events.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 291524-04-4 |
Sequence | HSDAVFTDNYARLRKQMAVKKALNSILA-NH₂ |
Synonyms | (Ala¹¹·²²·²⁸)-Aviptadil |
Molecular Formula | C₁₃₉H₂₃₁N₄₃O₃₉S |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product