Agouti-related Protein (AGRP) (83-132) Amide (human)

Catalog #	Pkg Size	Price(USD)	Quantity	Buy this product
R-M-1572	0.1mg	395.00	- +	+ Add to cart

Product description

Agouti related protein (AgRP) (83-132) amide (human) is a synthetic peptide.Our company can provide customized peptides.

Appearance	N/A
Molecular weight	N/A
Purity	>90%
Solubility	N/A
Sequence	SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT-NH2 (Cys5 and 20 bridge, Cys12 and 26 bridge, Cys19 and 37 bridge, Cys23 and 47 bridge, Cys28 and 35 bridge)
Molecular Formula	C235H362N76O67S11
Storage	-20℃, protected from light and moisture
Transportation	4-25℃ temperature for up to 3 weeks
Stability	1 year

Document