Adrenomedullin (22-52) (human) trifluoroacetate salt
H-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH₂ trifluoroacetate salt
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-613 | 0.5mg | 225.00 | + Add to cart |
|
R-M-613 | 1mg | 410.00 | + Add to cart |
|
|
Product description
Adrenomedullin (22-52) (human) trifluoroacetate salt,CAS : 159899-65-7 from ruixi.ADM (22-52) is a putative adrenomedullin receptor antagonist that inhibits the production of cAMP elicted by adrenomedullin. It is a more effective antagonist for adrenomedullin- and CGRP-specific receptors than α-CGRP (8-37) (human).
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >95% |
Solubility | N/A |
Cas | 159899-65-7 |
Sequence | TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH₂ |
Molecular Formula | C₁₅₉H₂₅₂N₄₆O₄₈ |
Storage | -20℃,protected from light and moisture |
Transportation | 4-25℃ temperature for up to 2 weeks |
Stability | 1 year |
Document
Related Product