ACTH (1-39) (mouse, rat) trifluoroacetate salt

H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Val-Ala-Glu-Asn-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH trifluoroacetate salt

Product description

ACTH (1-39) (mouse, rat) trifluoroacetate salt,CAS :77465-10-2 from ruixi.ACTH (1–39) is a member of the melanocortin receptor agonists, which stimulates the adrenal cortex and the secretion of glucocorticoids such as cortisol.

Appearance	N/A
Molecular weight	N/A
Purity	>95%
Solubility	N/A
Cas	77465-10-2
Sequence	SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF
Molecular Formula	C₂₁₀H₃₁₅N₅₇O₅₇S
Storage	-20℃,protected from light and moisture
Transportation	4-25℃ temperature for up to 2 weeks
Stability	1 year

Document

MSDS of ACTH (1-39) (mouse, rat) trifluoroacetate salt

Related Product

• acth-2-24-human-bovine-rat-trifluoroacetate-salt