3 x Hemagglutinin (HA) Tag

Catalog #	Pkg Size	Price(USD)	Quantity	Buy this product
R-M-1563	1mg	290.00	- +	+ Add to cart

Product description

This tag peptide may be used to detect proteins and peptides, and to facilitate functional analysis of proteins of interest.

Appearance	N/A
Molecular weight	N/A
Purity	>90%
Solubility	N/A
Sequence	H-Met-Glu-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Ala-Glu-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Ala-Glu-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Ala-Lys-Leu-Glu-OH (trifluoroacetate salt)/MEYPYDVPDYAAEYPYDVPDYAAEYPYDVPDYAAKLE
Molecular Formula	C205H272N38O67S1
Storage	-20℃, protected from light and moisture
Transportation	4-25℃ temperature for up to 3 weeks
Stability	1 year

Document

msds of 3 x Hemagglutinin (HA) Tag